PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3784s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 243aa    MW: 26935.9 Da    PI: 4.7893
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3784s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.4e-18170204135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+Cg+ +Tp+WR gp g ktLCnaCG+++++ +l
  Cagra.3784s0001.1.p 170 CSHCGVEETPQWRMGPLGAKTLCNACGVRFKSGRL 204
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.8E-831240IPR016679Transcription factor, GATA, plant
SMARTSM004014.5E-14164218IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.147164200IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-13167227No hitNo description
Gene3DG3DSA:3.30.50.104.7E-14168202IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440170195IPR000679Zinc finger, GATA-type
CDDcd002022.03E-14170226No hitNo description
PfamPF003201.8E-16170204IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MECVEALLGD FSVDDLFDFS NADTAFVRED ESSSSQREEE GEEDEQERDK AKSLSDQSTH  60
LSPLEDILSF PSDDVPVGNL ENLEWLSKFV EDSFSESYLS GDFPVSVDEA QNQRQCVPVK  120
PRSKRRRTNG RIWSLESTSP LLPTAVSGKK KRGKLTAEVS SGDGVQQRCC SHCGVEETPQ  180
WRMGPLGAKT LCNACGVRFK SGRLLPEYRP ACSPTFSTEI HSNSHRKVLE LRLMKSADPG  240
RV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284437.11e-157hypothetical protein CARUB_v10005611mg
SwissprotO655151e-128GATA7_ARATH; GATA transcription factor 7
TrEMBLR0GYE71e-157R0GYE7_9BRAS; Uncharacterized protein
STRINGAT4G36240.11e-125(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146541720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-119GATA transcription factor 7